PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G554300.1.p
Common NameLOC101766248, SETIT_036127mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 385aa    MW: 41233.7 Da    PI: 8.6382
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G554300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.4e-322578255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWtp+LH++Fv+a+++LGG++kAtPk++l+lm+v gLt++hvkSHLQ+YR 
  Seita.9G554300.1.p 25 PRLRWTPDLHHCFVHAIHKLGGQDKATPKRVLQLMGVGGLTISHVKSHLQMYRN 78
                        8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.6532181IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-312181IPR009057Homeodomain-like
SuperFamilySSF466896.81E-162380IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-242578IPR006447Myb domain, plants
PfamPF002497.5E-102677IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MTMVRTVVGR ERSGGVRQYN RSKVPRLRWT PDLHHCFVHA IHKLGGQDKA TPKRVLQLMG  60
VGGLTISHVK SHLQMYRNMR NDLGMQGSMQ VHRADHQEHI YGSGGMHIEL CNGMQQQCDH  120
ECDGPCCICR HSPKPRKEPM LPLHPQLKRT EPRREREEED YGSASPKSLL RGPGICESDG  180
SWCRALAAAA AAGGYNYMRV MQAAMGMAAP LPPHAEPEVE PRGGAGIKRQ QQQRPAAADG  240
EHAAPPPPPS DSKLFTFLGF VVAPGPPQPA CCSSSRDHPF EIAGRTPTQS VTTTASRLQC  300
SSLGTPSHKA VERRAAYNPP RPSSAHGCGG CSLSLSLALD AGSGGQCCTY SGEEGSLLSS  360
TTSATSGSRI SLDLSLSTLH PSSN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0689101e-100BT068910.1 Zea mays full-length cDNA clone ZM_BFc0191L18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698081.10.0PREDICTED: uncharacterized protein LOC101766248
TrEMBLK4AB700.0K4AB70_SETIT; Uncharacterized protein
STRINGSi036127m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76102950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.13e-27G2-like family protein